PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna18635.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 329aa    MW: 37898.2 Da    PI: 6.2736
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna18635.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.78e-52151431128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eel+++yL+kkv+g++++l +vi+evd++k+ePwd ++k++     +++wyfFs++dkky+tg+r+nrat++g+W
  mrna18635.1-v1.0-hybrid  15 VPPGFRFHPTEEELLQYYLRKKVSGQRIDL-DVIREVDLNKLEPWDVQEKCNIgttPQNDWYFFSHKDKKYPTGTRTNRATAAGFW 99 
                              69****************************.9***************964444222455*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk + s +   +g++ktLvfykgrap+g+k+dW+mheyrl
  mrna18635.1-v1.0-hybrid 100 KATGRDKVIRS-NCLRIGMRKTLVFYKGRAPRGQKSDWIMHEYRL 143
                              *********99.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-589174IPR003441NAC domain
PROSITE profilePS5100556.45215174IPR003441NAC domain
PfamPF023653.4E-2816143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MTENMSISVN GQSQVPPGFR FHPTEEELLQ YYLRKKVSGQ RIDLDVIREV DLNKLEPWDV  60
QEKCNIGTTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKVIRS NCLRIGMRKT  120
LVFYKGRAPR GQKSDWIMHE YRLDDNTSRI TNVSVVVGEA DQEGGWVVCR IFKKKNLHRP  180
MLSATTSSIT TDTTRSTHQL LYNSCDADEG ALEHELKVME SRTCNGCKEE TNEANNSLFM  240
NHIHGFHDDV DRFFNLPSLQ SPDSSAENDD QVSHQRVDWV GLTNWAALDR FVASELDGRE  300
MMTYPESGNY FITDHHDFHD HELQLPTTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-5291769170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004308279.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-125NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0H3VAS81e-138A0A0H3VAS8_9R
STRINGPOPTR_0002s17950.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-111NAC family protein